PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.002G009700.1
Common NamePOPTR_0002s01060g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 923aa    MW: 101292 Da    PI: 6.3543
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.002G009700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.82.5e-29612663152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Potri.002G009700.1 612 AEKTITLQVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGINRWPSRKIKKV 663
                         589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.655602683IPR003035RWP-RK domain
PfamPF020423.1E-25615663IPR003035RWP-RK domain
SuperFamilySSF542773.64E-24818909No hitNo description
PROSITE profilePS5174526.22825908IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2405.1E-22825905No hitNo description
SMARTSM006664.5E-27825908IPR000270PB1 domain
PfamPF005641.5E-19826907IPR000270PB1 domain
CDDcd064075.98E-38826905No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 923 aa     Download sequence    Send to blast
MEDGGLSPGT MLGATVDSVS VMDFDYMDEL LLEGCWLETT DGSEFLNPSL SNSAAFFDSS  60
FMWPTPEINH GDSASSPSQK GNQEDNQISM FPGNSTLSDI QARSPAGETA VSVAGWDDNA  120
TDGSELGKRW WIGPTPNPSV ETSVKRRLIK ALECIKDLTK NKDVLIQIWV PVNRGGRRVL  180
TTHDQPFSLD PSSEKLASYR DISVKYQFSA EEDSKDSVGL PGRVFLGKVP EWTPDVRFFR  240
SDEYPRVNHA QLYDVRGTLA LPVFEQGSRT CLGVIEVVTT SQKIKYRPEL ESVCKALETV  300
DLRSSEVPSI QNLQACNMSY QAALPEIQKL LRAACETHRL PLAQTWVPCT QQGKGGCRHS  360
NENYYRCVST VDDACCVADS AIQGFQEACS EHHLLKGQGV AGQAFMTNQP CFSGDVTSYG  420
KTEYPLSHHA RMFGLCAAVA IRLRSIYIGT TDFVLEFFLP VNCRDPQEQK KMLNSLSAII  480
QHVSQTLRVV TDKELVEETD LPFSEVLVPS DGRSSGEETS TVKQSCSERH SRDNSPWTAC  540
LSEVQPSGSN ISLSQKDKQK VMLREKSSEN RENQEDCSLR ESIKCGRDST SAEGSFSSAG  600
TSKTGEKRRA KAEKTITLQV LRQYFAGSLK DAAKSIGVCP TTLKRICRQH GINRWPSRKI  660
KKVGHSLKKL QRVIDSVEGA SGTVQIDSFY KNFPELASPT LSRTSPLSTL KSSSHPKPSG  720
MQPEGGTFSS QVTAPKSPSP SCSLGSSSSH SCSSGAIAAS EDPVSGENSG NGVLKMVRSN  780
VELHASSPGE QERMPRSQSH KTLAELGSIP PLSKDGSRLS QETDAHRLKV TYGNEIIRLR  840
MSNKWGFKDL LQEIVRRFNI DDIHRFDLKY LDDDSEWVLL TCDDDLEECI AICGSSDNQT  900
IKLLLEVSPR PLGRSSHSSG LS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002301919.20.0NIN-like protein 1
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLB9GQ070.0B9GQ07_POPTR; NIN-like protein 1
STRINGPOPTR_0005s27310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein